2. Signaling Pathways
  3. Metabolic Enzyme/Protease
  4. Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Related Products

PDF 1.4 MB

Angiotensin-converting enzyme (ACE) indirectly increases blood pressure by causing blood vessels to constrict. ACE does that by converting angiotensin I to angiotensin II, which constricts the vessels. ACE, angiotensin I and angiotensin II are part of the renin-angiotensin system (RAS), which controls blood pressure by regulating the volume of fluids in the body. ACE is secreted in the lungs and kidneys by cells in the endothelium (inner layer) of blood vessels. It has two primary functions: ACE catalyses the conversion of angiotensin I to angiotensin II, a potent vasoconstrictor in a substrate concentration-dependent manner. ACE degrades bradykinin, a potent vasodilator, and other vasoactive peptides. These two actions make ACE inhibition a goal in the treatment of conditions such as high blood pressure, heart failure, diabetic nephropathy, and type 2 diabetes mellitus. Inhibition of ACE (by ACE inhibitors) results in the decreased formation of angiotensin II and decreased metabolism of bradykinin, leading to systematic dilation of the arteries and veins and a decrease in arterial blood pressure.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-116023
    Moveltipril
    		Inhibitor 99.89%
    Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor.
    Moveltipril
  • HY-P99346
    Regdanvimab
    		Inhibitor
    Regdanvimab (CT-P59) is a human monoclonal antibody that targets the receptor-binding domain of SARS-CoV-2 spike protein, blocking interaction with ACE2 for viral entry. Regdanvimab can be used for the research of COVID-19.
    Regdanvimab
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
  • HY-N2533
    Cyanidin 3-sambubioside chloride
    		Inhibitor 98.50%
    Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC50 of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties.
    Cyanidin 3-sambubioside chloride
  • HY-100713
    Temocapril
    		Inhibitor 98.14%
    Temocapril is an orally active angiotensin-converting enzyme (ACE) inhibitor. Temocapril can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases.
    Temocapril
  • HY-118472
    Benazeprilat
    		Inhibitor ≥99.0%
    Benazeprilat is an orally active and the active metabolite of benazepril, a carboxyl-containing ACE inhibitor with antihypertensive activity. Benazepril is a well-established antihypertensive agent, both in monoresearch and in combination with other classes of drugs including thiazide diuretics and calcium channel blockers. Benazepril is a first-line research in reducing various pathologies associated with CV risk and secondary end-organ damage.
    Benazeprilat
  • HY-123348
    Sampatrilat
    		Inhibitor 99.22%
    Sampatrilat (UK-81252) is a potent and orally active vasopeptidase inhibitor of ACE and neutral endopeptidase (NEP). Sampatrilat inhibits C-domain ACE (Ki=13.8 nM) 12.4-fold more potent than that for the N-domain (Ki=171.9 nM). Sampatrilat (UK-81252) can be used for the study of chronic heart failure and blood pressure regulation.
    Sampatrilat
  • HY-P0318
    Hemorphin-7
    		Inhibitor
    Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).
    Hemorphin-7
  • HY-B1451A
    Imidapril
    		Inhibitor ≥99.0%
    Imidapril (TA-6366 free base) is an orally active angiotensin-converting enzyme (ACE) and MMP-9 inhibitor. Imidapril suppresses the conversion of angiotensin I to angiotensin II and thereby reduces total peripheral resistance and systemic blood pressure. Imidapril can be used for hypertension, type 1 diabetic, nephropathy and chronic heart failure research.
    Imidapril
  • HY-137875
    N-Benzoyl-Gly-His-Leu hydrate
    		98.61%
    N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.
    N-Benzoyl-Gly-His-Leu hydrate
  • HY-N7450
    Icariside D2
    		Inhibitor ≥98.0%
    Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
    Icariside D2
  • HY-P3141
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
  • HY-A0043A
    Cilazapril monohydrate
    		Inhibitor 99.94%
    Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
    Cilazapril monohydrate
  • HY-P0266A
    N-Acetyl-Ser-Asp-Lys-Pro TFA
    N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of ACE.
    N-Acetyl-Ser-Asp-Lys-Pro TFA
  • HY-127026
    Quinaprilat
    		Inhibitor
    Quinaprilat is an orally active non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat acts as anti-hypertensive agent and vasodilator.
    Quinaprilat
  • HY-18206S
    Lisinopril-d5
    		Inhibitor
    Lisinopril-d5 is the deuterium labeled Lisinopril. Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.
    Lisinopril-d<sub>5</sub>
  • HY-B0231BS
    Enalaprilat-d5 sodium
    		Inhibitor ≥98.0%
    Enalaprilat-d5 (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.
    Enalaprilat-d<sub>5</sub> sodium
  • HY-B0130
    Perindopril
    		Inhibitor 98.01%
    Perindopril erbumine is an angiotensin-converting enzyme inhibitor. Perindopril erbumine modulates NFκB and STAT3 signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure.
    Perindopril
  • HY-N9528
    Lyciumin A
    		Inhibitor ≥99.0%
    Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
    Lyciumin A
  • HY-A0043
    Cilazapril
    		Inhibitor
    Cilazapril is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
    Cilazapril
Cat. No. Product Name / Synonyms Species Source
Cat. No. Product Name / Synonyms Application Reactivity